Offline

cataleya1_sm

cataleya1_smis currently Offline. Expected back live in 23 hours.
In the meantime, 459 viewers are watching Megu_Melon live right now.
10

Preparing preview...

Now watching Megu_Melon on StripChat
459 viewers
Join Live
Megu_Melon

Get Extra Benefits

Create Your Free Account

Get a Free Membership

cataleya1_sm

Name: cataleya1_sm
Age: 23
Gender: Female
Location:
Followers: 3369
Viewers: 3
Languages:
Rank: 8720
Status: Offline
Last Online: 3 months ago on 10 December '25
Fingering ass
An intimate live cam moment with cataleya1_sm, happening now on StripChat

Enter the hypnotic domain of cataleya1_sm where every performance sparkles with seduction and fire. Watch the exclusive show on StripChat. A dazzling sexy Female, she mesmerizes with every touch of live passion. At 23 years, she exudes an aura of refined seduction and energy. Now offline, she is ready to set your pulse racing. Unlock graphs for an insight into her elaborate presence and ideal magnetism

The peak of her follower base was 3348 as recorded. At one stage, her follower count was recorded at 10 followers. Her average free-chat segment runs 73 minutes. The maximum continuous time she spent in free chat is 11.6 hours. She has conducted a total of 191 free chat sessions, overall digital metrics indicate 10 days banked in free chat. The overall duration she has been online amounts to 10 days. Her digital metrics register a private-average of 6 minutes, logs detail a private broadcast lasting 55 minutes, metrics confirm a total of 98 private sessions, complete engagement tally includes 10 hours of private time. Cataleya1_sm's highest observed viewer count is 11. her graphs reveal a total of 76 viewers across her shows

Her most recent live show saw the counter climb to 3348 followers, never dropped below 3302 followers all night. The most recent online stream roped in 46 new supporters. She held freechat for an average duration of 37 minutes on her last live day, reached a continuous freechat mark of 98 minutes in the recent live broadcast. That latest cumshow saw 6 freechat sessions. She registered 3.7 hours of freechat on her most recent day on stream, spent a solid 3.9 hours on cam in her last live session, newest cumshow recorded an average private time of 4 minutes. On her latest cam day, her top private run reached 5 minutes. During her most recent live exhibition, she hosted 4 private online shows. Her latest live day saw 15 minutes of private streams, recent cam run cruised along at 3 viewers, noted 2 viewers as the day's highest on her most recent live session. The most recent streaming day stacked 3 viewers

In her last month of live shows, she reached 3348 followers at peak. Her lowest follower total on any day in the past 30 days was 1122. Across the previous 30 days of streaming, she welcomed 2226 new followers, typical freechat session over the last month clocked 63 minutes. Across her last month of live displays, the top freechat duration was 8.3 hours. In her past 30 days of streaming, she completed 131 freechat sessions. Over her last month of live broadcasts, freechat time hit 6 days. During the past 30 days on cam, her total live time summed to 6 days. Over the past 30 days online, private sessions held 6 minutes on average. Throughout the past month, her longest time in private mode was 49 minutes. Across the previous 30 days, she recorded 67 private sessions. During her last month on screen, she averaged 2 viewers. Across her last 30 days, she peaked at 11 viewers in a single show. In the previous month of live showcases, she gathered 55 viewers

Total time

0mins
MaturehighlightedhotfeedwhiteindianspygirlsmilfsgroupactsgrouptitsassasianxmlhighlightedgirlshotguysgranniestransbabesanalarabteensbigprivateslatinyoungTeenpetitemature0Titsmixedbbwdildoguysactsebony